10.0 years

0.0 Lacs P.A.

Pune, Maharashtra, India

Posted:1 week ago| Platform: Linkedin logo

Apply Now

Skills Required

testtechnologytestingcontentmanagementsitecoreuiautomationstacksoftwaremetricsplanningefficiencysupportanalysisstandardizationtrainingcuttingdatadevelopmentdesignregressionagileengineeringprogrammingtypescriptwritingstrategiesdevops.netmodelcontrollermvcarchitecturedatabasequeryingsqlserverintegrationtroubleshootingscrumkanbanstatisticsreportingresearchcoachingazuretfsdeploymentdrive

Work Mode

On-site

Job Type

Full Time

Job Description

Job Purpose We, at Jet2 (UK’s third largest airlines and the largest tour operator), have set up a state-of-the-art Technology and Innovation Centre in Pune, India. We are looking for a Test Lead to join our team. Responsibilities Hands-on experience in Manual testing with strong knowledge of Content Management System – Sitecore Strategize the UI automation scope and ensure smooth execution Process oriented person capable of decision making. Prior experience in leading QA teams with a track record of successfully validating and delivering high-quality and scalable products. Solid experience in full stack web application testing Experience with software testing metrics, Test Planning, Different levels, types and methods of Testing Strong attention to detail and quality, and the ability to direct the team to adopt best practices. Ability to adapt quickly to changes and maintain high team morale and efficiency. Ability to work collaboratively with teams to address their needs, motivate them throughout the project, and identify opportunities to add their support directly when needed. Ability to provide oversight and analysis of work estimates and defend and articulate work efforts. Ensure the team adheres to established test case standardization & best practices. Ability to coordinate training sessions for senior and junior team members. Ability to work collaboratively in teams with other specialized individuals. Instill team empowerment, ownership, and accountability. Able to work in a fast-paced, technical environment with minimal oversight and in a professional manner. Ability to measure team and individual’s performance through standardized key performance indicators, and the ability to push the quality bar higher. Staying on top of cutting-edge testing techniques and trends, implementing the technologies, and ensuring higher quality products on projects. Build test plans, test scenarios, and test data to support development projects and project requirements, and design documents. Identify regression testing needs and create and maintain a regression suite. Work as part of cross-functional teams spread across India and the UK for developing and implementing Test best practices in an Agile environment. Essential Qualifications 10+ years of QA Engineering and strong knowledge of Content Management System (Preferably Sitecore) Proficient in any programming language (Ideally Typescript) and experience in any automation tool preferably Playwright 2+ years managing software testing teams and writing clear, concise, and comprehensive test strategies and plans 2+ Years working in DevOps and/or Agile environment Good knowledge of different .net frameworks and Model/View/Controller (MVC) architecture Good understanding of database querying using SQL Server. Experience in Web Application Testing, and System Integration Testing. Prior experience working with the UK teams. Good analysis and troubleshooting skills. Experience working with the following: Agile/SCRUM/Kanban methodologies Maintain and develop pertinent operational statistics, and results reporting Support and contribute to Business Development initiatives Research escalated issues to deliver coaching opportunities Bachelors/Masters/Doctorate in Computer Science or equivalent Perform other duties as assigned Nice To Have Exposure to Playwright based UI automation using Typescript Exposure to SAFE methodology Prior experience with Azure or any other cloud platforms, TFS , Octopus is a plus. Exposure to the containerized deployment model Ability to work in a cross-functional and cross-domain environment and drive discussions with various leaders across the company Show more Show less

No locations

RecommendedJobs for You

Chennai, Tamil Nadu, India

Hyderabad, Telangana, India

Bengaluru, Karnataka, India

Bengaluru, Karnataka, India

Mumbai, Maharashtra, India

Chennai, Tamil Nadu, India

Chennai, Tamil Nadu, India