.Net Full Stack Developer

6.0 years

0.0 Lacs P.A.

Gurugram, Haryana, India

Posted:2 days ago| Platform: Linkedin logo

Apply Now

Skills Required

.netstackdeveloperarchitecturesoftwaredevelopmentcodetestsupportautomationleadershiptechnologyresolveanalysistrainingdocumentationagileazureasp.netangularjavascripttypescripthtmlcsssqlserverdatabasedesignoptimizationtestingnunitmoqxunithealthcaresolrrabbitmqzookeepererlangredisintegrationtdd

Work Mode

On-site

Job Type

Full Time

Job Description

We are hiring for one the IT product-based company Location: Gurgaon Work Mode: Hybrid Job Description What you will do Major Responsibilities/Activities: Develop new features and maintain and enhance existing functionality Work within and maintain an extensible and performant system architecture Maintain a broad knowledge of emergent trends in software development platforms, tools, methodologies and their underlying principles Code review, unit test coverage and continuous improvement Build tools to support automation and productivity Communicate effectively with team members and project leadership to identify needs and evaluate alternative business solutions. Ensure unit tests written for all new code Seek opportunities to incorporate new technologies into the product’s technology stack when they can add value Work directly with support organizations to resolve production issues Provide application support by analyzing defects, replicating/fixing defects and providing root cause analysis for defects Troubleshoot and resolve functional and performance related issues Seek development opportunities above and beyond required training Serve as mentor for junior developers in the hard and soft skills required for success Participate in delivering team commitments, dev, QA, documentation, What you will bring Bachelor’s degree in computer science or experience through higher education 6+ years of experience in Software Development Experience in developing software in an Agile environment Microsoft Azure C#, ASP.Net Angular Javascript Typescript HTML / CSS / SCSS SQL Server database design, development & optimization Experience with unit testing frameworks (nUnit,Moq, XUnit, etc.) Excellent oral and written communications skills Travel required: None What we would like to see Healthcare domain knowledge Experience with the following: Solr RabbitMQ Meerkat Zookeeper Erlang Redis Cache Continuous Integration Test Driven Development (TDD) Seek development opportunities above and beyond required training Show more Show less

RecommendedJobs for You

Bengaluru East, Karnataka, India