IT Executive

0 years

0.0 Lacs P.A.

Chorasi, Gujarat, India

Posted:1 day ago| Platform: Linkedin logo

Apply Now

Skills Required

supportprocurementinventorymanagementserverdatatechnologycontrollerdhcpclusteringsnmpbackupstoragemonitoringazureawsgcpnetworktroubleshootingsoftwarefirewallvpnefficiencynetworkswaninstallationengineeringcommunication

Work Mode

Remote

Job Type

Full Time

Job Description

Diploma/CS/B Tech/BE holder (Freshers/Experience ) Candidate must provide the support & services to end users. IT procurement, inventory management, Help desk support services. Handle Client, Server & Data center technology infrastructure IT infrastructure setup & support at various MRU sites Server administration on domain controller, DNS, DHCP, Terminal server services, clustering, filer, SNMP & print server services etc. Administration on Virtual Hyper converge Infrastructure like HyperV, VM Ware, Nutanix etc. Administration on Backup & storage technology, Data center infrastructure administration which consists of servers, storage, UPS, Precision Air Conditioner (PAC), CCTV, Fire system, water detection system, access control, 24x7 Data center monitoring systems etc. Cloud infrastructure administration like Azure, AWS, GCP etc. Network infrastructure support & services Monitoring, operating, and providing troubleshooting of network platforms such as routers, switches, firewalls etc. Maintain & manged network platform inventory. Performing recurring support activities related to end-user workstations, telephony and software for both local and remote users. Maintain and troubleshoot both local area and wide area network links, including firewall, remote access and VPN software and hardware. Designing and implementing new network solutions and/or improving the efficiency of current networks. Installing, configuring, implementation and supporting network equipment including routers, proxy servers, switches, Wireless devices, Wireless controllers and WAN devices. Managing subcontractors involved with network installation. Skills Required: - Diploma Freshers / Experience holder IT/Computer/EC/Electronics/telecommunications engineering or related any engineering discipline. HE IT shall impart required skill sets to mange above responsibilities. Ability to work independently, analytical and problem-solving skills. Ability to work in a fast-paced environment. Good communication skills. Resource must be stationed at HE - IC, Hazira, Surat and Travel to the other L&T site as when required. Show more Show less

Larsen & Toubro
Not specified
[ ]

RecommendedJobs for You