Digital Marketing Intern - SMM & Graphics

0 years

0.0 Lacs P.A.

India

Posted:1 week ago| Platform: Linkedin logo

Apply Now

Skills Required

marketinggraphicswritingdesignvideolearningmentoringtrainingsupportreportseditingsoftwarecreativityportfoliodurationassessmenttestmanufacturingsecurityiotdevelopmentportalcontenttechnologymobile

Work Mode

Remote

Job Type

Internship

Job Description

#Job ID: PUN-IN/SMM250530040IN| Digital Marketing Intern - SMM & Graphics (Unpaid) IMPORTANT: Assignment / Samples Required for Application. Read the full Job Description for Instructions Internship Overview: This internship is for the Public Relations department of PMN Patralok - a division of Punama Innovation. We believe in not only quality writing but also in quality expressions by any means. Design, images, shorts, reels and other graphics are some of the best mediums to reach our audience quickly. We are looking for people who can express their thought process or vibes through short video clips or posters and can convert a journalist’s post into a social media post. Here at our organisation, we believe in learning, we believe in togetherness, and we believe in guiding and mentoring our people towards their progress and well-being. Here we give much time to each other in training, guidance and support so that our values and standards can be set high. We invite passionate people who are ready to learn, take challenges, have compassion and can devote more than 4 - 5 hours daily (5 days a Week, Weekly roster-based). You get plenty of week offs, exam leaves and support! Applications are invited for: Digital Marketing Intern - SMM & Graphics Work includes: Converting News articles shared by the Journalism team into Posters, Reports, etc. Designing high-quality Social Media Creatives. Ensuring Quality and timely completion of the projects. Advising on best practices and optimisations. Working in Teams with Journalists and Marketing. Having attention to detail. Skills Required: Knowledge of Graphics Editing Software (Inkscape, Illustrator, Canva or any other Graphics editing software) Basics of Motion Graphics Editing Techniques Attention to detail Problem Solving Creativity Portfolio showcasing Graphics editing skills Qualifications: Bachelor's degree / pursuing or higher in a related field People already working and looking for a change in career Women who want to restart their career after a family break and meet the necessary academic and other qualifications mentioned IMPORTANT (Sample Prescribed Format): Writing / Design or any other Work samples and preferred duration needed to proceed with the Interview Send your work samples and preferred duration with the below subject line at mariya.john@punama.in Email Subject FORMAT: #Job ID: PUN-IN/SMM250530040IN| Digital Marketing Intern - SMM & Graphics | Example: #Job ID: PUN-IN/SMM250530040IN | Digital Marketing Intern - SMM & Graphics | Ritesh Kumar Perks: Certificate on completion of the Internship Flexible Working Hours Great Learning Opportunity – More than training, we give you challenges to learn with guidance and support Great Mentorship Work from Home opportunity Every month, there will be a mandatory review of the Intern’s work efforts. Based on the review, the Internship will be either extended or terminated. Prerequisites for internship extension: Seriousness - as seen in work performance Learnability - How much the candidate is willing and trying to learn Understandability - How much the candidate understands the situation/work. Even if they do not, they are trying hard to be understood. Responsibility – Although there is not much about shifty timings, how responsible the candidate is in delivering the work on time. Hiring Procedure: Candidate Applies via LinkedIn Candidates apply online with required samples and a Resume HR reviews applications for initial suitability. Applications without any sample/ assignment or with samples/ assignments that are not in the prescribed format are rejected without any intimation or response to the candidates. Shortlisted candidates receive a confirmation email and the JD (to reconfirm) from the TA charge via email Basic HR Telephonic discussion After email, shortlisted candidates will get a phone call from HR for an initial discussion & screening. Assessment (Objective Questions) and F2F Video Interview on a live Google Meet call Selected candidates take a skills-based online test while sharing their screen on Google Meet or an automated assessment software (anyone applicable) - To be executed or planned based on the Hiring Team’s Decision F2F Interview in the same Meet Call or a separately fixed meeting Results will be declared by the next working weekday about the final result or any further steps. Company Overview: We are hiring for the News and Media vertical of Punama Innovation, called PMN Patralok, which was launched in 2023. Punama Innovation is an IT-based Organisation, dealing with Software and Embedded systems-based services and Manufacturing. We work on Cloud solutions, Cloud security, Embedded Systems & IoT development, Firmware development, customised Embedded manufacturing, etc. PMN Patralok is a News portal, a team of Journalists who like to explore, understand, uncover and present the information of whatever is happening around us, whether local or international, scientific or artistic, natural or human-developed. We like to present the news simplistically, with easy and simple understandable language. At the start, we are going to deliver our content in Hindi and English, and our work domain includes Geo Politics, International Relations, Crime, Politics, Sports, Entertainment, Lifestyle, Health, Technology, Gadgets, Science, Culture, etc. For any further queries, reach out to: TA In-charge: Mariya John Mobile: +91 9947270564 Email: mariya.john@punama.in Show more Show less

Punama Innovation
Not specified
[ ]

RecommendedJobs for You