.Net Developer - ASP/C# (5-12 yrs)

5.0 - 10.0 years

2.0 - 6.0 Lacs P.A.

Pune

Posted:2 weeks ago| Platform: Naukri logo

Apply Now

Skills Required

web apimvcc#.netaspcssweb servicesado.netnet developmentajaxjquerysqljavaasp.nethtmlmysqlapiwcfentity frameworkmicrosoft azurevbsql serverazure cloudjavascriptangularlinq.net corescrumagileangularjs

Work Mode

Work from Office

Job Type

Full Time

Job Description

Title SSE - Dotnet + ESG / Sustainability Experience 5 to 8 years / 8 to 12 years Location (Pune/Mumbai/Kolkata/Hyderabad/Bangalore/Noida) Notice Period Immediate or upto 31st may 2025 About The Role We are seeking experienced .NET Developers with strong proficiency in C# and the .NET framework, ideally with exposure to Azure Cloud technologies. The ideal candidate should also have prior experience or exposure in the ESG (Environmental, Social, and Governance) domain, working on platforms or applications aligned with sustainability, compliance, or data reporting. Key Responsibilities - Design, develop, and maintain robust applications using C# and other .NET technologies (.NET Core, ASP.NET, etc.) - Integrate and deploy applications on Microsoft Azure or other cloud platforms - Work closely with ESG business teams to understand domain-specific requirements - Participate in end-to-end development lifecycle from design to deployment - Write clean, scalable, and well-documented code adhering to industry best practices - Collaborate with cross-functional teams to deliver efficient software solutions - Troubleshoot and resolve application issues or bugs efficiently - Ensure application performance, scalability, and security Skills & Qualifications - Proficient in C#, .NET Core, ASP.NET, MVC, Web API, SQL Server - Experience with cloud platforms, preferably Microsoft Azure - Hands-on experience or domain understanding of ESG/Sustainability platforms or tools - Familiarity with Agile/Scrum development methodologies - Strong problem-solving skills and attention to detail - Excellent communication and teamwork abilities Apply Insights Follow-up Save this job for future reference Did you find something suspiciousReport Here! Hide This Job Click here to hide this job for you. You can also choose to hide all the jobs from the recruiter.

RecommendedJobs for You