UI React Developer

1.0 - 4.0 years

11.0 - 15.0 Lacs P.A.

Bengaluru

Posted:1 week ago| Platform: Naukri logo

Apply Now

Skills Required

reduxcssreact.jshtmljavascriptnextjsui developmentgituireact testing librarywebpackwireframetypescriptgraphqlui/uxrestfrontend developmentuxuser interface designingnpmjestbabeldesign principlesagileresponsive web design

Work Mode

Work from Office

Job Type

Full Time

Job Description

Project description The UI Full-stack Developer will be responsible for developing dynamic, interactive, and scalable web applications using React.js and C#.net. You will collaborate closely with UX/UI designers, backend developers, and product managers to build engaging and high-quality front-end solutions that align with our business goals. Responsibilities Full-stack DevelopmentBuild responsive and dynamic web applications using React.js and related technologies (JavaScript, HTML5, CSS3) on C#.net backend. Component DevelopmentCreate reusable and efficient React components to ensure the maintainability and scalability of web applications. CollaborationWork closely with designers to translate wireframes and prototypes into interactive web pages, ensuring seamless user experiences. IntegrationIntegrate front-end components with backend APIs (REST/GraphQL) and ensure smooth data flow between the frontend and backend. Code QualityWrite clean, efficient, and maintainable code, and ensure the use of best practices such as unit testing, version control, and documentation. Performance OptimizationOptimize web applications for speed, scalability, and responsiveness across various devices and browsers. Cross-Team CoordinationCollaborate with backend developers, product managers, and other stakeholders to define technical requirements and project timelines. Bug Fixing & TroubleshootingIdentify and fix performance bottlenecks, bugs, and other issues in the user interface. Continuous LearningStay updated with the latest industry trends and emerging technologies in React and front-end development. Skills Must have 6+ years of professional experience in front-end development with a strong focus on React.js. Bachelor's degree in Computer Science, Engineering, or a related field (or equivalent experience). Proficient in JavaScript (ES6+), HTML5, CSS3, and responsive web design principles. Strong knowledge of React.js, Redux, and React Hooks. Experience with front-end build tools such as Webpack, Babel, and npm/yarn. Familiarity with version control systems like Git and modern development workflows. Experience with RESTful APIs and asynchronous request handling. Knowledge of cross-browser compatibility issues and ways to work around them. Understanding of UI/UX principles and attention to detail when implementing designs. Familiarity with testing frameworks such as Jest, Enzyme, or React Testing Library. Nice to have Experience with TypeScript and its integration with React. Knowledge of Next.js or similar server-side rendering frameworks. Familiarity with GraphQL and its integration with front-end applications. Experience working in an agile environment. Knowledge of performance optimization techniques for front-end applications. Experience with accessibility best practices (WCAG). Other Languages EnglishB2 Upper Intermediate Seniority Senior

IT Services and IT Consulting
Zug New York +90

RecommendedJobs for You

Trivandrum, Kerala, India

Trivandrum, Kerala, India

Bengaluru, Karnataka, India

Bengaluru, Karnataka, India