User Experience Designer

4.0 years

0.0 Lacs P.A.

Gurugram, Haryana, India

Posted:6 days ago| Platform: Linkedin logo

Apply Now

Skills Required

uxuidesignstorytellingcreativityvisionempathyfusionstrategyshopifymobiledriveengagementfigmanavigationvisualconsistencyresearchsurveysusabilitytestingprototypingtestcollaborativesynergyoptimizationanalyticsportfoliomarketingwireframinghtmlcssdevelopmentintegrityaccessibilityseodiscoverycollaboration

Work Mode

On-site

Job Type

Full Time

Job Description

UX/UI Designer Location : Gurgaon, Haryana, India (On-site) Company : Protein World Salary : ₹8–10 LPA Essence : A harmonious blend of intuitive design, empathetic storytelling, and transformative creativity Our Vision Protein World is a radiant movement, igniting self-actualization and empowering lives through premium health and fitness solutions. We are architects of inspiration, fostering a high-vibration community that thrives on positivity, purpose, and wellness. From our vibrant Gurgaon hub, we energize the world, inviting passionate visionaries to join us in crafting a legacy of transformation. The Role We seek a UX/UI Designer, a creative alchemist who will shape Protein World’s digital experiences with elegance and empathy. This role is a fusion of artistry and strategy, where you will design intuitive, visually stunning interfaces for our Shopify website and mobile platforms, resonating with our wellness-driven community. Your designs will inspire connection, drive engagement, and embody our mission to uplift lives through seamless, authentic digital journeys. Key Responsibilities User-Centric Design : Craft intuitive UX flows and wireframes using tools like Figma, ensuring seamless navigation and user delight on Protein World’s Shopify website and mobile platforms. Visual Brilliance : Create high-fidelity UI designs that harmonize Protein World’s bold, wellness-focused aesthetic with modern design principles, enhancing brand consistency. Empathetic Research : Conduct user research (e.g., surveys, usability testing) to understand our community’s needs, translating insights into designs that foster aspiration and connection. Prototyping Mastery : Build interactive prototypes to test and refine user experiences, iterating based on feedback to elevate functionality and engagement. Collaborative Synergy : Partner with developers, marketers, and creative teams to align designs with technical feasibility and brand goals, fostering shared purpose. Insightful Optimization : Leverage basic analytics (e.g., heatmaps, Google Analytics) to refine designs, ensuring sustained impact and a vibrant user experience. Who You Are You are a beacon of creativity, empathy, and passion, with a spirit that resonates with Protein World’s high-vibration energy. We seek: Experience : 2–4 years in UX/UI design, with a proven track record of designing for e-commerce or consumer-facing platforms (portfolio required). Education : A Bachelor’s degree in Design, Human-Computer Interaction, Marketing, or a related field is preferred; a marketing degree is a strong advantage. Skills : Expertise in Figma, Adobe XD, or similar design tools for wireframing, prototyping, and UI design. Proficiency in user research methods and usability testing. Familiarity with Shopify’s design ecosystem and responsive design principles. Basic understanding of HTML/CSS or front-end development is a plus. Creative Passion : An innate ability to design interfaces that are innovative, elegant, and infused with wellness-inspired authenticity, balancing bold vision with meticulous execution. Qualities : Exceptional emotional intelligence, integrity, and a radiant, proactive spirit. You are organized, adaptable, and thrive in a dynamic environment where creativity and purpose converge. Advantage : Experience with wellness, fitness, or premium consumer brands, or skills in motion design, accessibility standards, or SEO, is highly valued. Why Protein World? A Noble Calling : Shape a brand that transcends products, inspiring wellness and self-discovery on a global stage. Transformative Impact : Design experiences that resonate deeply, fostering connection within our vibrant community. A Refined Collective : Join a passionate team in our Gurgaon office, where creativity, integrity, and high-energy collaboration thrive. Elevated Growth : Expand your expertise, forge meaningful connections, and enjoy perks like health insurance, gym access, and product discounts. Show more Show less

Protein World
Not specified
[ ]

RecommendedJobs for You

Chennai, Tamil Nadu, India