2 - 7 years

4.0 - 9.0 Lacs P.A.

Trivandrum

Posted:2 months ago| Platform: Naukri logo

Apply Now

Skills Required

microservicesspring bootcritical thinkingjavadebuggingrestprotocol stackmicrosoft azuresolution deliveryspringjmstechnical consultingkafka brokerssolution designsaasgcpkafkaagileapiawsgraphqldata integration

Work Mode

Work from Office

Job Type

Full Time

Job Description

About The Role Must have: Java , SpringBoot , Microservices. Good to Have Kafka or GraphQL What will you do? Interact and collaborate with customers andpartners to define the integration landscape. Define the logical sequence of integrationactivities for a SaaS onboarding project. Coordinate with the product development teamto implement recommended integration strategies. Improve overall project delivery experienceand go-live time by improving process and documentation. Support cloud infrastructure and systemcomponents required for integration. Lead the identification, isolation,resolution, and communication of issues within a client environment. What do Ineed to succeed? Must have Worked on at least one end to end SaaSimplementation project. 2+ years of application and data integrationexperience. Experience with clustering and highavailability configurations. Agile experience. Designed an end-to-end scalable integrationsolution. Broad exposure to different technology stacksinvolved in a SaaS delivery model. Broad and in-depth knowledge of o data integration concepts and tools o network protocol stacks and related integrationparadigms o security postures in integration technologystacks o API design and API based integration o Azure, AWS and GCP public cloud platforms andprovided services and their integration approaches o Integration frameworks used by SaaS applications. Skilled technical documenter. Solution designer at heart. Experience in using modeling tools to createeffective architecture views. Strong organizational, analytical, criticalthinking, and debugging skills. Excellent communication skills. Ability to break down complex technical andfunctional requirements and effectively articulate / communicate them todifferent stakeholders involved in a project. Self-starter willing to get involved in allaspects of solution delivery including implementation and processimprovement. Broad picture minded - one who sees theend-to-end solution of a project. Nice to have Domain knowledge of banking and financialinstitutions and/or large enterprise IT environment. Strong delivery experience with geographicallydistributed delivery and client teams. Strong knowledge and hands-on experience withsetting up and configuration of Kafka brokers. Strongknowledge and experience with the Kafka Connect Framework including workingwith multiple connector typesHTTP, RESTful APIs, JMS check(event) ; career-website-detail-template-2 => apply(record.id,meta)" mousedown="lyte-button => check(event)" final-style="background-color:#6875E2;border-color:#6875E2;color:white;" final-class="lyte-button lyteBackgroundColorBtn lyteSuccess" lyte-rendered=""> I'm interested

RecommendedJobs for You

Chennai, Pune, Mumbai, Bengaluru, Gurgaon

Chennai, Pune, Delhi, Mumbai, Bengaluru, Hyderabad, Kolkata

Pune, Bengaluru, Mumbai (All Areas)