Sr. Full Stack .Net Developer (.Net+ Angular 5+ Years - Ahmedabad)

5 - 10 years

0.0 Lacs P.A.

Ahmedabad, Gujarat, India

Posted:4 weeks ago| Platform: Linkedin logo

Apply Now

Skills Required

stack.netdeveloperangulardesigndevelopmentcodingcustomizationconfigurationtestingdeploymentsupportsoftwareasp.netapisqltypescripthtmlarchitectureservicetechnologyestimationriskplanningcodetestmanagementoptimizationtroubleshootingreliabilityagiledatacommunicationcollaboration

Work Mode

On-site

Job Type

Full Time

Job Description

We are looking for an experienced and ambitious .NET Fullstack Developer to join our team. As a .NET FullStack Developer, you will be involved in design, development, coding, customization, configuration, testing, and deployment to support enterprise-packaged solutions. Role:- Sr. .NET FullStack Developer / Lead DeveloperExperience:- 5 to 10 YearsLocation:- Ahmedabad Role & responsibilities:Develop, and maintain high-quality software applications using .NET Core, Angular, ASP.NET Core, Web API, C#, and SQL Server.Develop, and maintain responsive and user-friendly web applications using Angular (10+), TypeScript, HTML, and CSS.Collaborate with product managers, designers, and other team members to deliver high-quality software solution.Understand requirements, create and review designs, validate the architecture and ensure a high level of service offerings to clients in the technology domain.Participate in project estimation, provide inputs for solution delivery, conduct technical risk planning, and perform code reviews and unit test plan reviews.Lead and guide your teams towards developing optimized high quality code deliverables, continual knowledge management and adherence to the organizational guidelines and processes.Perform code optimization and troubleshooting to ensure optimal performance and reliability. Qualifications:Bachelor’s degree in Computer Science, Information Technology, or a related field.Minimum of 5 years of experience in full-stack development, with a focus on .NET technologies.Proficiency in .NET Core, C#, SQL, and Angular is essential.Strong understanding of web development principles and best practices.Experience with agile development methodologies and version control systems.Experience working with large-scale data sets and complex data transformations.Excellent problem-solving and analytical skills.Excellent communication and collaboration skills. Interested candidates are invited to send their CVs to career@praeclarumtech.com.

Praeclarum Tech
Not specified
No locations

Employees

9 Jobs

RecommendedJobs for You