Software Developer

0.0 - 1.0 years

0.0 Lacs P.A.

Thiruvananthapuram, Kerala

Posted:2 weeks ago| Platform: Indeed logo

Apply Now

Skills Required

softwaredevelopertestmvcarchitecturejavascriptuiuxdesigncodecodingscalabilitydevelopmentagilitylearninglogisticsengineeringwmsjqueryasp.netapihtmlcsssqlserverqueryintegrationplanning

Work Mode

On-site

Job Type

Full Time

Job Description

Key Responsibilities: Develop, test, and deploy responsive and interactive web applications using MVC architecture with client side as JavaScript frameworks. Collaborate with UI/UX designers to translate design mock-ups into functional and visually appealing web applications. Write clean, maintainable, and efficient code following best practices and coding standards. Optimize web applications for performance, scalability, and cross-browser compatibility. Troubleshoot and debug issues to ensure smooth and efficient application performance. Participate in code reviews and contribute to the continuous improvement of development processes. Remain updated with the latest technologies and contribute innovative ideas for product enhancement. Demonstrate agility in learning and adapting to the logistics domain and apply the same in solving the same on our platform. Qualifications and Experience: Bachelor’s degree in computer science, Engineering, or a related field. 1-4 Years max in software development. Preference to candidate who have experience in WMS or Logistics IT services products. Key Skills: Proficiency in C#, JavaScript, jQuery, ASP.NET Core, Web API, HTML, and CSS. Strong skills in SQL Server development, capable of handling complex requirements and optimizing techniques for maximum query performance. Develop, and enhance RESTful APIs that are efficient, scalable, and compliant with industry standards, facilitating seamless integration with external systems and services. Job Types: Full-time, Permanent Benefits: Health insurance Life insurance Provident Fund Ability to commute/relocate: Thiruvananthapuram, Kerala: Reliably commute or planning to relocate before starting work (Required) Experience: required tech: 1 year (Required) Work Location: In person

GEMINI
Not specified
No locations

Employees

3 Jobs

RecommendedJobs for You