Reactjs Developer

3 - 8 years

5.0 - 9.0 Lacs P.A.

Chennai

Posted:2 months ago| Platform: Naukri logo

Apply Now

Skills Required

moment jsreduxcssstylusjqueryreact.jsjavaapachegcpslackhtmlmysqlsasstypescriptcommunication skillsjirapythonbddoraclenginxsvgmicrosoft azurejestjavascriptrubyamazon sqsangularunderscore.jsnode.jssaastddlephpyarn

Work Mode

Work from Office

Job Type

Full Time

Job Description

Should have minimum 3 years experience Proficiency with fundamental front end languages such as HTML, CSS and JavaScript. Familiarity with JavaScript frameworks such as React JS, Angular JS and Amber. Familiarity with one or more of the server side languages such as Python, Ruby, Java, PHP and .Net. Familiarity with database technology such as MySQL, Oracle and MongoDB. Excellent verbal communication skills. Good problem solving skills. Attention to detail. Requirements Knowledge of React Hooks, React Context API and Redux. Deep understanding of HTML, CSS, SASS/LESS/Stylus/SVG. Experience in JavaScript, Typescript/ Libraries: jQuery, MomentJS, Underscore and Lodash. JavaScript tools: npm, Yarn, Node.js platform, Automate building: Webpack, Parcel or Rollup. Exposure of TDD, BDD, Unit Tests and testing tools like Jest or Enzyme. Jasmine, Karma, Mocha. Cloud platforms like SaaS, Amazon AWS, Google Cloud, or Microsoft Azure. PM tools: Jira/ Servers: NGINX, Apache/ Online collaboration tools: Slack or Miro. Join the team Thank you for your keen interest in becoming a part of aBrandr. Were eagerly looking forward to gaining deeper insights into your candidacy through this application.

Marketing & Branding
Brand City

RecommendedJobs for You

Chennai, Pune, Delhi, Mumbai, Bengaluru, Hyderabad, Kolkata

Pune, Bengaluru, Mumbai (All Areas)

Chennai, Pune, Delhi, Mumbai, Bengaluru, Hyderabad, Kolkata

Bengaluru, Hyderabad, Mumbai (All Areas)

Hyderabad, Gurgaon, Mumbai (All Areas)