M365 Architect

5.0 years

0.0 Lacs P.A.

vadodara, gujarat, india

Posted:5 days ago| Platform: Linkedin logo

Apply Now

Skills Required

technologydevelopmentnetworkscommunicationsecurityriskefficiencydataservicesharepointonedrivecompliancearchitecturedesigndeploymentplanningconfigurationmigrationtroubleshootingcollaborationdocumentationnetworkingintegrationpresentationagilemanagementcertifications

Work Mode

On-site

Job Type

Full Time

Job Description

About Us: Exigo Tech specialises in providing end-to-end technology solutions in Infrastructure, Cloud, Enterprise Application Development, Networks and Internet, Digital Transformation, Business Communication and Modern Workplace. We have forayed into the Security domain as well. We have a team of certified professionals who bring both defensive and offensive cyber security solutions to all levels of Enterprise and Government customers for risk mitigation. At Exigo Tech we have a firm commitment to our clients for delivering solutions which enable them to increase their business efficiency and productivity while ensuring the security of their data. We follow industry-standard processes in our organisation. We work to create a great customer experience whilst solving complex security challenges with innovative solutions to ensure we address your outcomes and help against any possible threats to your organisation. #Great place to work certified 2023-2024 #Outstanding Employer Choice Award 2023 - WSABE We are ISO 27001:2022 certified organization. Visit our website: https://exigotech.co/ for more details…. LinkedIn: https://www.linkedin.com/company/exigotech/ As an M365 Architect for our Managed Service Provider (MSP), you will be responsible for designing, implementing, and maintaining Microsoft 365 solutions for our clients. You will work closely with our clients to understand their business requirements and translate them into effective M365 solutions that meet their needs. This role requires a deep understanding of Microsoft 365 technologies, including Exchange Online, SharePoint Online, Teams, OneDrive for Business, and security and compliance features. Roles & Responsibilities Designing Microsoft 365 solutions based on client requirements, including architecture design, deployment planning, and configuration. Leading the implementation of Microsoft 365 solutions, including migration from on-premises environments to the cloud. Providing technical expertise and guidance to clients and internal teams on Microsoft 365 best practices and solutions. Troubleshooting and resolving issues related to Microsoft 365 services, including email, collaboration, and security. Developing and maintaining documentation, including architecture diagrams, configuration guides, and operational procedures. Collaborating with other teams, such as security, networking, and infrastructure, to ensure seamless integration of Microsoft 365 services. Staying current with Microsoft 365 updates, new features, and industry trends to provide recommendations for continuous improvement. Participating in pre-sales activities, including technical assessments, solution presentations, and proposal development. Technical Skills: Proven experience designing and implementing Microsoft 365 solutions for medium to large enterprises. Deep understanding of Microsoft 365 services, including Exchange Online, SharePoint Online, Teams, OneDrive for Business, and security and compliance features. Experience with Microsoft 365 migration tools and methodologies. Excellent communication and presentation skills, with the ability to communicate technical concepts to non-technical stakeholders. Ability to work independently and collaboratively in a fast-paced environment, managing multiple projects simultaneously. Stay abreast of the latest trends and developments in the industry and identify and evaluate new opportunities and technologies for M365 Core. Experience working in both Agile and Waterfall delivery models. Experience working for a Managed Service Provider (MSP) is preferred but not required. Excellent troubleshooting and communication skills Able to work well in a team setting. Excellent organizational and time management skills. Self-driven, flexible, and innovative. Embody our Culture and Values Qualifications Bachelor’s degree in computer science, Information Technology, or related field. Microsoft certifications such as Microsoft 365 Certified: Enterprise Administrator Expert, Microsoft Certified: Security, Compliance, and Identity Fundamentals, or equivalent experience. Experience: 5+ years Job Location: Vadodara, Gujarat, India (WFO) Show more Show less

Exigo Tech
Not specified
[ ]

RecommendedJobs for You

vadodara, gujarat, india

vadodara, gujarat, india

vadodara, gujarat, india