Lead- Product Manager (Supply Chain)

10.0 years

0.0 Lacs P.A.

Bengaluru, Karnataka, India

Posted:1 week ago| Platform: Linkedin logo

Apply Now

Skills Required

strategyprocurementanalyticsinventorymanagementforecastingplanningdatadrivescrumconnectflowvisionprioritizationretentiondevelopmentagilityserviceefficiencytechnologymanufacturing

Work Mode

On-site

Job Type

Full Time

Job Description

Job Responsibilities  Product Strategy & Roadmap: Define and own the product roadmap, ensuring alignment with business objectives and digital transformation goals for products like Procurement Analytics, Inventory Management, Demand forecasting, supply planning.  Owner of various Data Product roadmaps that drive the various scrum releases and user stories  Partnership with various business Product owners, Data Owners, IT platform owners and the Data & Analytics delivery organization  Connect with specific regions/Business Lines, understand source systems, data and process flow, problem areas and partner with them to ideate on relevant data and analytics product ideas  Lead the product vision, roadmap and feature definition and iterative prioritization – act as the product owner for the scrum delivery team  Guide hiring, retention, and talent development in an area of technical, application, and domain expertise aligned to organizational vision.  Ownership & Accountability: Drive product initiatives with a high level of ownership, demonstrating the scrappiness and agility needed to thrive in a fast-moving environment.  Partner with data science and analytics organizations across the enterprise to scale service, solution, and product impact.  Innovation & Problem Solving: Identify and champion new opportunities for innovation within UPL’s digital ecosystem, particularly those that improve processes, increase efficiency, and deliver value to the end-user. Required Education And Experience  10-14 years of overall experience in technology with good focus on Data & Analytics, supply chain products spanning into demand forecasting, procurement analytics, planning, some parts of manufacturing etc.  5+ years of experience with Data Products management  Awareness of overall technology landscape in Data & Analytics  Deep functional knowledge and the value story across the various Data & Analytics products managed Public  Experience working with Product Owners, Data owners and D&A delivery organization We are one team, for maximum impact. One team with shared goals. We all play for the team, and no-one plays against team. We have a laser-like focus on what our customers need and want, on anticipating their future needs and how we can create innovative solutions and experiences for them. Skills: management,demand forecasting,procurement analytics,data & analytics,problem solving,data,scrum methodology,analytics,forecasting,inventory management,drive,supply chain management,supply,innovation,roadmap management,product strategy Show more Show less

eDataBae
Not specified
[ ]

RecommendedJobs for You