Lead Engineer - Frontend

4 - 7 years

13.0 - 17.0 Lacs P.A.

Bengaluru

Posted:2 months ago| Platform: Naukri logo

Apply Now

Skills Required

react.jsreduxkubernetescssbootstrapajaxjquerydockerelastic searchjavawebpackgcphtmlmysqltypescriptgraphqlgraphql apismongodbrestmicrosoft azurenpmcloud platformsjestjavascriptcypressangularnode.jsbabelawsangularjs

Work Mode

Work from Office

Job Type

Full Time

Job Description

About us: Working at Target means helping all families discover the joy of everyday life. We bring that vision to life through our values and culture. . As a lead engineer, you serve as the technical anchor for the engineering team that supports a product. You create, own and are responsible for the application architecture that best serves the product in its functional and non-functional needs. You identify and drive architectural changes to accelerate feature development or improve the quality of service (or both). You have deep and broad engineering skills and are capable of standing up an architecture in its whole on your own, but you choose to influence a wider team by acting as a force multiplier. Core responsibilities of this job are described within this job description. Job duties may change at any time due to business needs. We are seeking an experienced Lead Front-End Engineer to drive the development of high-performance, scalable, and maintainable web applications. You will be responsible for architecting and leading the implementation of Micro Front-End architectures, Back-End for Front-End (BFF) patterns, and Module Federation across our projects. You will also lead the team in adopting modern front-end technologies, defining best practices, and ensuring the delivery of high-quality code. Key Responsibilities: Lead the design and architecture of scalable, modular front-end applications using React JS , Micro Front-End Architecture , and Module Federation . Guide the implementation of Back-End for Front-End (BFF) layers to optimize communication between front-end and back-end systems. Drive the adoption of Module Federation for code-sharing and modularization across multiple micro front-end applications. Mentor and lead a team of front-end engineers, setting coding standards, conducting code reviews, and ensuring high-quality deliverables. Collaborate with design, product, and back-end teams to align on front-end architecture and data flow. Lead the integration of RESTful APIs and GraphQL with front-end applications, ensuring seamless interaction with back-end services. Advocate for best practices in front-end performance optimization, accessibility, and test-driven development. Manage the CI/CD pipeline and ensure efficient deployment of front-end applications. Stay up-to-date with emerging front-end technologies and frameworks, driving innovation within the team. Required Skills: 8+ years of relevant in frontend skills HTML5 , CSS3 , JavaScript/TypeScript , and ES6 . Extensive experience with React JS , including advanced concepts such as custom hooks , Redux , React Router , and React Context . Expertise in Micro Front-End Architecture , with a focus on creating modular, independent front-end applications. Strong experience with Module Federation to share and dynamically load code between multiple front-end applications. Deep understanding of Back-End for Front-End (BFF) patterns for optimized front-end-backend communication. Experience leading and mentoring engineering teams, with a focus on code quality, performance, and testing. Proficiency with Webpack , Babel , NPM , and modern front-end build tools. Expertise with front-end testing frameworks like Jest , Cypress , and Enzyme . Experience with accessibility standards and implementing WCAG -compliant applications. Strong experience with cloud platforms and modern deployment practices (AWS, GCP, Azure). Familiarity with GraphQL and working with GraphQL APIs. Experience with containerization technologies (e.g., Docker ) and orchestration platforms like Kubernetes . Experience in mentoring and leading cross-functional teams. Strong communication skills and ability to collaborate with stakeholders across product, design, and engineering teams.

RecommendedJobs for You

Nasik, Pune, Nagpur, Mumbai, Thane, Aurangabad