Big Data Developer

0 years

0.0 Lacs P.A.

Agra, Uttar Pradesh, India

Posted:1 week ago| Platform: Linkedin logo

Apply Now

Skills Required

datadeveloperarchitecturedesignetlextractstacksparkscalapythonsupportvisiontechnologyconsistencyautomationmentoringdevopsagilekanbanazureengineeringpysparknifikubernetesdockerhivezookeeperpostgresqlrabbitmqelasticsearchawsservicesaaslatencyapiflowgitmessagingrediscontainerizationtestingresthtmljavascriptangulartypescript.netjavacryptographyintegrationmockingdiversitydevelopmentleadershipsoftwaredocumentationvirtualizationumlsequencemanagementpivotintegrityapachehadoop

Work Mode

On-site

Job Type

Full Time

Job Description

Major Accountabilities Collaborate with the CIO on application Architecture and Design of our ETL (Extract, Transform, Load) and other aspects of Data Pipelines. Our stack is built on top of the well-known Spark Ecosystem (e.g. Scala, Python, etc.) Periodically evaluate architectural landscape for efficiencies in our Data Pipelines and define current state, target state architecture and transition plans, road maps to achieve desired architectural state Conducts/leads and implements proof of concepts to prove new technologies in support of architecture vision and guiding principles (e.g. Flink) Assist in the ideation and execution of architectural principles, guidelines and technology standards that can be leveraged across the team and organization. Specially around ETL & Data Pipelines Promotes consistency between all applications leveraging enterprise automation capabilities Provide architectural consultation, support, mentoring, and guidance to project teams, e.g. architects, data scientist, developers, etc. Collaborate with the DevOps Lead on technical features Define and manage work items using Agile methodologies (Kanban, Azure boards, etc) Leads Data Engineering efforts (e.g. Scala Spark, PySpark, etc) Knowledge & Experience Experienced with Spark, Delta Lake, and Scala to work with Petabytes of data (to work with Batch and Streaming flows) Knowledge of a wide variety of open source technologies including but not limited to; NiFi, Kubernetes, Docker, Hive, Oozie, YARN, Zookeeper, PostgreSQL, RabbitMQ, Elasticsearch A strong understanding of AWS/Azure and/or technology as a service (Iaas, SaaS, PaaS) Strong verbal and written communications skills are a must, as well as the ability to work effectively across internal and external organizations and virtual teams Appreciation of building high volume, low latency systems for the API flow Core Dev skills (SOLID principles, IOC, 12-factor app, CI-CD, GIT) Messaging, Microservice Architecture, Caching (Redis), Containerization, Performance, and Load testing, REST APIs Knowledge of HTML, JavaScript frameworks (preferably Angular 2+), Typescript Appreciation of Python and C# .NET Core or Java Appreciation of global data privacy requirements and cryptography Experience in System Testing and experience of automated testing e.g. unit tests, integration tests, mocking/stubbing Relevant Industry And Other Professional Qualifications Tertiary qualifications (degree level) We are an inclusive employer and welcome applicants from all backgrounds. We pride ourselves on our commitment to Equality and Diversity and are committed to removing barriers throughout our hiring process. Key Requirements Extensive data engineering development experience (e.g., ETL), using well known stacks (e.g., Scala Spark) Experience in Technical Leadership positions (or looking to gain experience) Background software engineering The ability to write technical documentation Solid understanding of virtualization and/or cloud computing technologies (e.g., docker, Kubernetes) Experience in designing software solutions and enjoys UML and the odd sequence diagram Experience operating within an Agile environment Ability to work independently and with minimum supervision Strong project development management skills, with the ability to successfully manage and prioritize numerous time pressured analytical projects/work tasks simultaneously Able to pivot quickly and make rapid decisions based on changing needs in a fast-paced environment Works constructively with teams and acts with high integrity Passionate team player with an inquisitive, creative mindset and ability to think outside the box. Skills:- Java, Scala, Apache Spark, Spark, Hadoop and ETL Show more Show less

ATF Labs
ATF Labs
Not specified
No locations

RecommendedJobs for You

Agra, Uttar Pradesh, India

Hyderabad, Telangana, India

Hyderabad, Telangana, India

Pune, Maharashtra, India

Chennai, Tamil Nadu, India